DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and PSR1

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_013091.1 Gene:PSR1 / 850650 SGDID:S000003933 Length:427 Species:Saccharomyces cerevisiae


Alignment Length:273 Identity:85/273 - (31%)
Similarity:138/273 - (50%) Gaps:53/273 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RSRSSSDRRGLVLILLSSDLGTYIRRL-LARVAEKA---------------------CTILR--T 71
            :|:|.|.:||..:.:.|..|   |:.: |:||:..:                     .|:|:  .
Yeast   176 QSQSQSQQRGPTVQVSSDHL---IQDMNLSRVSSSSQASETSNDADDEDDEDEEYIDLTLLQQGQ 237

  Fly    72 YLGLSYREVSVSQDMAHRLAVVGRKTLVLDLDETLVHSC--YLDPDTHDNVGCSQLPEHAQPDYV 134
            |....|..:...||.:.:    |:|.|:||||||||||.  ||                ...|:|
Yeast   238 YHAPGYNTLLPPQDESTK----GKKCLILDLDETLVHSSFKYL----------------RSADFV 282

  Fly   135 LNISIDGMEPIVFRVFKRPHVDEFLDFVSKWYDLVIYTASLEVYAAQVVDHLDAGRGLITRRFYR 199
            |::.||.....|: |.|||.|:|||:.|.|.:::|::|||:..|...::|.||..: :|..|.:|
Yeast   283 LSVEIDDQVHNVY-VIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTDK-VIHHRLFR 345

  Fly   200 QHCRASSPMVSKDLTLVTPDMSGVLIIDNSPYAYRDFPDNAIPIKTFIYDPDDTELLKMLPFLD- 263
            :.|........|:|:.:...:|.::|:||||.:|...|.:||||.::..|..|.|||.::|.|: 
Yeast   346 EACYNYEGNYIKNLSQIGRPLSDIIILDNSPASYIFHPQHAIPISSWFSDTHDNELLDIIPLLED 410

  Fly   264 -ALRFTKDVRSIL 275
             :::.:.||..||
Yeast   411 LSVKTSLDVGKIL 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 63/178 (35%)
PSR1NP_013091.1 FCP1 6..427 CDD:227517 85/273 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.