DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and AT1G29780

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_174271.1 Gene:AT1G29780 / 839856 AraportID:AT1G29780 Length:221 Species:Arabidopsis thaliana


Alignment Length:224 Identity:79/224 - (35%)
Similarity:123/224 - (54%) Gaps:36/224 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 CTILR------TYLGLSYREVSVSQDMAHRL--AVVG----RKTLVLDLDETLVHSCYLDPDTHD 118
            |.:||      |.:.:||...........:|  .:.|    ::|::|||||||||:     .|| 
plant     8 CRLLRCVSRCFTGITISYPATKHGYTKFEKLEDPLTGYTNMKRTIILDLDETLVHA-----TTH- 66

  Fly   119 NVGCSQLP--EHAQPDYVLNISIDGMEPIVFRVF--KRPHVDEFLDFVSKWYDLVIYTASLEVYA 179
                  ||  :|   |:::.:.   ||..:..:|  |||.|.|||:.:.:.|.:|::||.||.||
plant    67 ------LPGVKH---DFMVMVK---MEREIMPIFVVKRPGVTEFLERLGENYKVVVFTAGLEEYA 119

  Fly   180 AQVVDHLDAGRGLITRRFYRQHCRASSPMVSKDLTLVT-PDMSGVLIIDNSPYAYRDFPDNAIPI 243
            :||:|.||. .|:|::|.||..|...:....|||:||. .|:...||:|::|.:|...|:|.:||
plant   120 SQVLDKLDK-NGVISQRLYRDSCTEVNGKYVKDLSLVVGKDLRSALIVDDNPSSYSLQPENGVPI 183

  Fly   244 KTFIYDPDDTELLKMLPFLDALRFTKDVR 272
            |.|:.|..|.|||.::.||::....:|:|
plant   184 KAFVDDLKDQELLNLVEFLESCYAYEDMR 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 69/179 (39%)
AT1G29780NP_174271.1 HIF-SF_euk 49..210 CDD:274055 69/179 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.