DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and AT1G29770

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_174270.1 Gene:AT1G29770 / 839855 AraportID:AT1G29770 Length:278 Species:Arabidopsis thaliana


Alignment Length:254 Identity:87/254 - (34%)
Similarity:137/254 - (53%) Gaps:29/254 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GLVLILLSSDLGTYIRRLLARVA--------EKACTILRTYLGLSYREVSVSQDMAHRLAVVGRK 96
            |.:...|:..:.|:..|||..|:        ..|....|..:...|:::...:.:..|..  .::
plant    41 GSIFTSLNMSIFTFHNRLLRCVSRFLRLATTSSATPTRRPTMKQGYKKLHKREPLIRRND--KKR 103

  Fly    97 TLVLDLDETLVHSCYLDPDTHDNVGCSQLPEHAQPDYVLNISIDGMEPIVFRVFKRPHVDEFLDF 161
            |:.||||||||||. ::|....||           |:::.|.|:|....:| |.|||.|.|||:.
plant   104 TIFLDLDETLVHST-MEPPIRVNV-----------DFMVRIKIEGAVIPMF-VVKRPGVTEFLER 155

  Fly   162 VSKWYDLVIYTASLEVYAAQVVDHLDAGRGLITRRFYRQHCRASSPMVSKDLTLVTP-DMSGVLI 225
            :||.|.:.|:||.|..||:||:|.||..| :|::|.||..|...:...:|||:||.. |:..||:
plant   156 ISKNYRVAIFTAGLPEYASQVLDKLDKNR-VISQRLYRDSCTEVNGRYAKDLSLVAKNDLGSVLL 219

  Fly   226 IDNSPYAYRDFPDNAIPIKTFIYDPDDTELLKMLPFLDALRFTKDVR----SILGRRVI 280
            :|::|::|...|||.:|||.|:.|.:|.||:|:..|.|.....:|:|    .:|..::|
plant   220 VDDNPFSYSLQPDNGVPIKPFMDDMEDQELMKLAEFFDGCYQYEDLRDAAAELLSSKLI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 72/175 (41%)
AT1G29770NP_174270.1 HIF-SF_euk 102..264 CDD:274055 72/175 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.