DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and SSP4

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001119383.1 Gene:SSP4 / 834684 AraportID:AT5G46410 Length:456 Species:Arabidopsis thaliana


Alignment Length:186 Identity:77/186 - (41%)
Similarity:107/186 - (57%) Gaps:23/186 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 TLVLDLDETLVH----SCYLDPDTHDNVGCSQLPEHAQPDYVLNISIDGMEPIVFRVFKRPHVDE 157
            ||||||||||||    ||        ||.          |:...:..:..|..|: |.:|||:..
plant   285 TLVLDLDETLVHSTLESC--------NVA----------DFSFRVFFNMQENTVY-VRQRPHLYR 330

  Fly   158 FLDFVSKWYDLVIYTASLEVYAAQVVDHLDAGRGLITRRFYRQHCRASSPMVSKDLTLVTPDMSG 222
            ||:.|.:.:.:||:|||..:||:|::|.||.....|::||||..|.....:.:||||::..|::.
plant   331 FLERVGELFHVVIFTASHSIYASQLLDILDPDGKFISQRFYRDSCILLDGIYTKDLTVLGLDLAK 395

  Fly   223 VLIIDNSPYAYRDFPDNAIPIKTFIYDPDDTELLKMLPFLDALRFTKDVRSILGRR 278
            |.||||.|..||...:|.||||::..||.|..|:.:||||:.|....|||.|:|||
plant   396 VAIIDNCPQVYRLQINNGIPIKSWYDDPTDDGLITILPFLETLAVADDVRPIIGRR 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 70/176 (40%)
SSP4NP_001119383.1 HIF-SF_euk 284..443 CDD:274055 70/176 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1004
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.