DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and SSP4b

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001031661.2 Gene:SSP4b / 827539 AraportID:AT4G18140 Length:446 Species:Arabidopsis thaliana


Alignment Length:281 Identity:92/281 - (32%)
Similarity:138/281 - (49%) Gaps:52/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RSRSSSDRRGLVLILLSSDLGTYIRRLLARVAEKA--------------CTILRTYLGLS----- 76
            ||.||.|        :.||....|.|..::..|.|              ...||....|:     
plant   196 RSASSDD--------VKSDEDNRINRSRSKNLEAAENHTEAEQTEDFDPQIFLRNQPELADVVFN 252

  Fly    77 -YREVSVSQDMAHRLAVVGRKTLVLDLDETLVHSCYLDPDTHDNVGCSQLPEHAQPDYVLNISID 140
             :.::...:|...|.||    ||||||||||||              |.|......|:...::.:
plant   253 YFPDMQQPRDSPKRKAV----TLVLDLDETLVH--------------STLEVCRDTDFSFRVTFN 299

  Fly   141 GMEPIVFRVFKRPHVDEFLDFVSKWYDLVIYTASLEVYAAQVVDHLDAGRGLITRRFYRQHCRAS 205
            ..|..|: |.:||::..||:.|.:.:.:||:|||..:||:|::|.||.....:::||||..|..|
plant   300 MQENTVY-VKQRPYLYRFLERVVELFHVVIFTASHSIYASQLLDILDPDGKFVSQRFYRDSCILS 363

  Fly   206 SPMVSKDLTLVTPDMSGVLIIDNSPYAYRDFPDNAIPIKTFIYDPDDTELLKMLPFLDALRFTKD 270
            ..:.:||||::..|::.|.|:||.|..||...:|.||||::..||.|..|:.:||||:.|....|
plant   364 DGIYTKDLTVLGLDLAKVAIVDNCPQVYRLQINNGIPIKSWYDDPTDDGLITLLPFLETLADAND 428

  Fly   271 VRSILGRRVIRHYYNRSTISS 291
            ||.::.:|     ::.||.||
plant   429 VRPVIAKR-----FDHSTRSS 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 66/174 (38%)
SSP4bNP_001031661.2 HIF-SF_euk 269..423 CDD:274055 66/172 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1004
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.