DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and AT3G55960

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_191155.1 Gene:AT3G55960 / 824762 AraportID:AT3G55960 Length:305 Species:Arabidopsis thaliana


Alignment Length:243 Identity:75/243 - (30%)
Similarity:109/243 - (44%) Gaps:48/243 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LLARVAEKACTILRTYLGLSYREVSVSQDMAHRLAVVGRKTLVLDLDETLVHSCYLDPDTHDNVG 121
            ||.|.:|...|:   .:..:....|.|.....|..   |..:|||||||||  |..:        
plant    65 LLDRASESPTTV---EIAATTTSDSCSDGARSRFQ---RLKVVLDLDETLV--CAYE-------- 113

  Fly   122 CSQLPEHAQPDYV-------------LNISIDGMEPIVF-RVFKRPHVDEFLDFVSKWYDLVIYT 172
            .|.||...:...:             .:...||...|.: .||:||.:.|||:.:|::.||:::|
plant   114 TSSLPAALRNQAIEAGLKWFELECLSTDKEYDGKPKINYVTVFERPGLHEFLEQLSEFADLILFT 178

  Fly   173 ASLEVYAAQVVDHLDAGRGLITRRF--------YRQHCRASSPMVSKDLTLVTPDMSGVLIIDNS 229
            |.||.||..:||.:|..:.|..|.:        ||.|.        |||...:.:|...:|:||:
plant   179 AGLEGYARPLVDRIDTRKVLTNRLYRPSTVSTQYRDHV--------KDLLSTSKNMCRTVIVDNN 235

  Fly   230 PYAYRDFPDNAIPIKTF-IYDPDDTELLK-MLPFLDALRFTKDVRSIL 275
            |:::...|.|.||...| ...|:||:||. :||.|..|....|||..|
plant   236 PFSFLLQPSNGIPCIAFSAGQPNDTQLLDVILPLLKQLSEEDDVRPTL 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 63/198 (32%)
AT3G55960NP_191155.1 HAD_like 97..278 CDD:419670 63/198 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.