DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and Ublcp1

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_077795.2 Gene:Ublcp1 / 79560 MGIID:1933105 Length:318 Species:Mus musculus


Alignment Length:222 Identity:50/222 - (22%)
Similarity:80/222 - (36%) Gaps:81/222 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 GRKTLVLDLDETLVHSCYLDPDTHDNVGCSQLPEHAQPDYVLNISIDGMEPIVFRVFKRPHVDEF 158
            |:|.||||:|.||          .|:..|::               .|:|      ..||::.||
Mouse   136 GKKLLVLDVDYTL----------FDHRSCAE---------------TGVE------LMRPYLHEF 169

  Fly   159 LDFVSKWYDLVIYTAS----LEV--------------------YAAQVVDHLDAGRGLITRRFYR 199
            |....:.||:||::|:    :|.                    .||.:..|... ||||..:...
Mouse   170 LTSAYEDYDIVIWSATNMKWIEAKMKELGVSTNANYKITFMLDSAAMITVHTPR-RGLIDVKPLG 233

  Fly   200 QHCRASSPMVSKDLTLVTPDMSGVLIIDNSPYAYRDF---PDNAIPIKTF----IYDPDDTELLK 257
            ......|...||..|::..|:.            |:|   |.|.:.|:.|    :....|.||:|
Mouse   234 VIWGKFSEFYSKKNTIMFDDIG------------RNFLMNPQNGLKIRPFMKAHLNRDKDKELVK 286

  Fly   258 MLPFLDALRFTKDVRSILGRRVIRHYY 284
            :..:|      |::..:.....:.|.|
Mouse   287 LTQYL------KEIAKLDDFLELNHKY 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 46/205 (22%)
Ublcp1NP_077795.2 Ubl_UBLCP1 3..77 CDD:340511
HAD_IIID1 117..311 CDD:131299 50/222 (23%)
Phosphatase. /evidence=ECO:0000250 133..294 48/207 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.