DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and ublcp1

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:XP_021324596.1 Gene:ublcp1 / 792145 ZFINID:ZDB-GENE-040718-3 Length:371 Species:Danio rerio


Alignment Length:189 Identity:42/189 - (22%)
Similarity:74/189 - (39%) Gaps:55/189 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 GRKTLVLDLDETLVHSCYLDPDTHDNVGCSQLPEHAQPDYVLNISIDGMEPIVFRVFKRPHVDEF 158
            |::.||||:|.||          .|:..|::               .|.|      ..||.:.||
Zfish   189 GKRLLVLDIDYTL----------FDHKSCAE---------------TGHE------LMRPFLHEF 222

  Fly   159 LDFVSKWYDLVIYTASLEVYAAQVVDHLDAGRGLITRRFYRQHCRASSPMVSKDLTLVTPDMSGV 223
            |....:.:|:||::|:    :.:.:|......|:.....|:......|..:   :|:.||...  
Zfish   223 LTSAYEDFDIVIWSAT----SMKWIDAKMKELGVTDNPNYKITFMLDSAAM---ITVHTPKRG-- 278

  Fly   224 LIIDNSPYA-----YRDFPDNAIPI------KTFIYDPDDTELLKMLPFLDA-LRFTKD 270
             :::..|..     |.:|.:....|      :.|:.:|.:.  ||:.||:.| |...||
Zfish   279 -VVEVKPLGVIWGKYSEFYNRKNTIMFDDIGRNFLMNPQNG--LKIRPFMKAHLNREKD 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 39/186 (21%)
ublcp1XP_021324596.1 UBQ 59..130 CDD:320785
HAD_IIID1 170..364 CDD:131299 42/189 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.