Sequence 1: | NP_610404.1 | Gene: | CG8584 / 35856 | FlyBaseID: | FBgn0033322 | Length: | 293 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005162767.1 | Gene: | ctdspla / 751737 | ZFINID: | ZDB-GENE-060825-333 | Length: | 276 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 71/197 - (36%) |
---|---|---|---|
Similarity: | 109/197 - (55%) | Gaps: | 24/197 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 79 EVSVSQDMAHRLAVVGRKTLVLDLDETLVHSCYLDPDTHDNVGCSQLPEHAQPDYVLNISIDGME 143
Fly 144 PIVFRVFKRPHVDEFLDFVSKWYDLVIYTASLEVYAAQVVDHLDAGRGLITRRFYRQHCRASSPM 208
Fly 209 VSKDLTLVTPDMSGVLIIDNSPYAYRDFPDNAIPIKTFIYDPDDTELLKMLPFLDALRFTKDVRS 273
Fly 274 IL 275 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8584 | NP_610404.1 | HIF-SF_euk | 95..270 | CDD:274055 | 63/174 (36%) |
ctdspla | XP_005162767.1 | KCNQ2_u3 | 14..92 | CDD:293248 | |
FCP1 | <95..272 | CDD:227517 | 71/197 (36%) | ||
HIF-SF_euk | 106..265 | CDD:274055 | 63/174 (36%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5190 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1176152at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |