DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and Ctdspl

DIOPT Version :10

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_598471.3 Gene:Ctdspl / 69274 MGIID:1916524 Length:276 Species:Mus musculus


Alignment Length:184 Identity:71/184 - (38%)
Similarity:107/184 - (58%) Gaps:16/184 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 GRKTLVLDLDETLVHSCYLDPDTHDNVGCSQLPEHAQPDYVLNISIDGMEPIVFRVFKRPHVDEF 158
            |:|.:|:|||||||||.:              ...:..|:::.:.|||....|: |.||||||||
Mouse   105 GKKCVVIDLDETLVHSSF--------------KPISNADFIVPVEIDGTIHQVY-VLKRPHVDEF 154

  Fly   159 LDFVSKWYDLVIYTASLEVYAAQVVDHLDAGRGLITRRFYRQHCRASSPMVSKDLTLVTPDMSGV 223
            |..:.:.::.|::||||..||..|.|.||.. |:...|.:|:.|........|||:.:..::|.|
Mouse   155 LQRMGQLFECVLFTASLAKYADPVADLLDRW-GVFRARLFRESCVFHRGNYVKDLSRLGRELSKV 218

  Fly   224 LIIDNSPYAYRDFPDNAIPIKTFIYDPDDTELLKMLPFLDALRFTKDVRSILGR 277
            :|:||||.:|...|:||:|::::..|..|||||.::||.:.|....||.|:|.|
Mouse   219 IIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSREDDVYSMLHR 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 65/174 (37%)
CtdsplNP_598471.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
HIF-SF_euk 106..265 CDD:274055 65/174 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.