DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and Ctdp1

DIOPT Version :10

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_080571.2 Gene:Ctdp1 / 67655 MGIID:1926953 Length:960 Species:Mus musculus


Alignment Length:225 Identity:56/225 - (24%)
Similarity:90/225 - (40%) Gaps:51/225 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 SYREVSVSQDMAHRLAVVGRK-----------TLVLDLDETLVHSCYLDPDTHDNVGCSQLPEHA 129
            |..|:.||.:.|.:|   ||:           .|::|||:||:|:    .:.|    |.|:....
Mouse   155 SVPELMVSSEQAEKL---GREDQQRLHRNRKLVLMVDLDQTLIHT----TEQH----CPQMSNKG 208

  Fly   130 QPDYVLNISIDGMEPIVFRVFKRPHVDEFLDFVSKWYDLVIYTASLEVYAAQVVDHLDAGRGLIT 194
                :.:..:...||:: ....|||..:||:.::|.|:|.::|....:||..:...||..:.|.:
Mouse   209 ----IFHFQLGRGEPML-HTRLRPHCKDFLEKIAKLYELHVFTFGSRLYAHTIAGFLDPEKKLFS 268

  Fly   195 RRFY-RQHCRASSPMVSKDLTLVTPDMSGVLIIDNSPYAYRDFPDNAIPIKTFIYDPDDTELLKM 258
            .|.. |..|............|.....|.|.|||:....:: |..|.|.:|.::|.|.       
Mouse   269 HRILSRDECIDPFSKTGNLRNLFPCGDSMVCIIDDREDVWK-FAPNLITVKKYVYFPG------- 325

  Fly   259 LPFLDALRFTKDV------RSILGRRVIRH 282
                     |.||      |....||.:.|
Mouse   326 ---------TGDVNAPPAARETQARRKVNH 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 43/186 (23%)
Ctdp1NP_080571.2 biotinyl_domain 27..111 CDD:133459
FCP1_euk 177..323 CDD:131304 39/159 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 331..580 4/16 (25%)
BRCT_CTDP1 611..713 CDD:349361
FCP1_C 706..960 CDD:462751
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 770..834
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 854..948
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.