DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and Timm50

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_079892.1 Gene:Timm50 / 66525 MGIID:1913775 Length:353 Species:Mus musculus


Alignment Length:173 Identity:47/173 - (27%)
Similarity:84/173 - (48%) Gaps:20/173 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 LPE-----HAQPDYVLNISIDG--MEP-----IVFRVFKRPHVDEFLDFVSKWYDLVIYTASLEV 177
            ||:     :.||.|.|.:.:.|  :.|     ..:|..|||.::.....::..|::||:|:...:
Mouse   135 LPDPLREPYYQPPYTLVLELTGVLLHPEWSLATGWRFKKRPGIETLFQQLAPLYEIVIFTSETGM 199

  Fly   178 YAAQVVDHLDAGRGLITRRFYRQHCRASSPMVSKDLTLVTPDMSGVLIIDNSPYAYRDFPDNAIP 242
            .|..::|.:|. .|.|:.|.:|...|.......||::.:..|.:.|:::|....|:|..|.|.:.
Mouse   200 TAFPLIDSVDP-HGFISYRLFRDATRYMEGHHVKDISCLNRDPARVVVVDCKKEAFRLQPFNGVA 263

  Fly   243 IKTFIYDPDDTELLKMLPFLD--ALRFTKDVRSILGRRVIRHY 283
            ::.:..:.||..||.:..||.  ||...:|||::|     .||
Mouse   264 LRPWDGNSDDRVLLDLSAFLKTIALNQVEDVRTVL-----EHY 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 41/158 (26%)
Timm50NP_079892.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..59
NIF 148..295 CDD:281081 38/147 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.