DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and ctdsp1

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:XP_021334687.1 Gene:ctdsp1 / 553744 ZFINID:ZDB-GENE-050522-523 Length:1222 Species:Danio rerio


Alignment Length:183 Identity:69/183 - (37%)
Similarity:104/183 - (56%) Gaps:16/183 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 VGRKTLVLDLDETLVHSCYLDPDTHDNVGCSQLPEHAQPDYVLNISIDGMEPIVFRVFKRPHVDE 157
            ||:..:|:|||||||||.:...:              ..|:::.:.|||....|: |.|||||||
Zfish  1049 VGKICVVIDLDETLVHSSFKPVN--------------NADFIIPVEIDGTVHQVY-VLKRPHVDE 1098

  Fly   158 FLDFVSKWYDLVIYTASLEVYAAQVVDHLDAGRGLITRRFYRQHCRASSPMVSKDLTLVTPDMSG 222
            ||..:.:.::.|::||||..||..|.|.||.. |....|.:|:.|........|||:.:..|::.
Zfish  1099 FLKRMGELFECVLFTASLAKYADPVSDLLDKW-GAFRSRLFRESCVFHRGNYVKDLSRLGRDLNK 1162

  Fly   223 VLIIDNSPYAYRDFPDNAIPIKTFIYDPDDTELLKMLPFLDALRFTKDVRSIL 275
            |:|:||||.:|...||||:|:.::..|..|||||.::||.:.|....:|.::|
Zfish  1163 VIIVDNSPASYIFHPDNAVPVASWFDDMSDTELLDLIPFFERLSKVDNVYTVL 1215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 65/174 (37%)
ctdsp1XP_021334687.1 HIF-SF_euk 1051..1209 CDD:274055 65/173 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.