DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and ctdnep1

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001017177.1 Gene:ctdnep1 / 549931 XenbaseID:XB-GENE-5939296 Length:244 Species:Xenopus tropicalis


Alignment Length:244 Identity:117/244 - (47%)
Similarity:157/244 - (64%) Gaps:13/244 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RGLVLILLSSDLGTYIRRLLARVAEKACTILRTYLGLSYREVSVSQDMAHRLAVVGRKTLVLDLD 103
            ||.|  ..::.|.:::..||.|   :..||:: |..:.|..:.:|....:||:.|.||.||||||
 Frog    11 RGFV--AFAAKLWSFVLYLLRR---QVRTIIQ-YQTVRYDVLPLSPASRNRLSQVKRKVLVLDLD 69

  Fly   104 ETLVHSCYLDPDTHDNVGCSQLPEHAQPDYVLNISIDGMEPIVFRVFKRPHVDEFLDFVSKWYDL 168
            |||:||      .||.|....:.....||::|.:.|| ..|:.|.|.||||||.||:.||:||:|
 Frog    70 ETLIHS------HHDGVLRPTVRPGTPPDFILKVVID-KHPVRFFVHKRPHVDFFLEVVSQWYEL 127

  Fly   169 VIYTASLEVYAAQVVDHLDAGRGLITRRFYRQHCRASSPMVSKDLTLVTPDMSGVLIIDNSPYAY 233
            |::|||:|:|.:.|.|.||..||::.||||||||........|||::|..|:|.|:|:||||.||
 Frog   128 VVFTASMEIYGSAVADKLDNNRGVLRRRFYRQHCTLELGSYIKDLSVVHSDLSSVVILDNSPGAY 192

  Fly   234 RDFPDNAIPIKTFIYDPDDTELLKMLPFLDALRFTKDVRSILGRRVIRH 282
            |..||||||||::..||.||.||.:||.|||||||.||||:|.|.:.:|
 Frog   193 RSHPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQH 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 95/174 (55%)
ctdnep1NP_001017177.1 HIF-SF_euk 61..229 CDD:274055 95/174 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 1 1.000 - - FOG0002783
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1870
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.