DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and ctdnep1b

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001007441.2 Gene:ctdnep1b / 492799 ZFINID:ZDB-GENE-041114-152 Length:248 Species:Danio rerio


Alignment Length:230 Identity:113/230 - (49%)
Similarity:148/230 - (64%) Gaps:14/230 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 YIRRLLARVAEKACTILRTYLGLSYREVSVSQDMAHRLAVVGRKTLVLDLDETLVHSCYLDPDTH 117
            ||.|...|      ||:: |..:.|..:|:|....:||..|.||.|||||||||:||      .|
Zfish    30 YILRKHIR------TIIQ-YQTVRYDVLSLSPISRNRLNNVKRKILVLDLDETLIHS------HH 81

  Fly   118 DNVGCSQLPEHAQPDYVLNISIDGMEPIVFRVFKRPHVDEFLDFVSKWYDLVIYTASLEVYAAQV 182
            |.|....:.....||::|.:.|| ..|:.|.|.||||||.||:.||:||:||::|||:|:|.:.|
Zfish    82 DGVLRPTVRPGTPPDFILKVVID-KHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSAV 145

  Fly   183 VDHLDAGRGLITRRFYRQHCRASSPMVSKDLTLVTPDMSGVLIIDNSPYAYRDFPDNAIPIKTFI 247
            .|.||..:.::.||:|||||...|....|||::|..|:|.|:|:||||.|||..||||||||::.
Zfish   146 ADKLDNNKAILKRRYYRQHCTLDSGSYIKDLSVVHDDLSSVVILDNSPGAYRSHPDNAIPIKSWF 210

  Fly   248 YDPDDTELLKMLPFLDALRFTKDVRSILGRRVIRH 282
            .||.||.||.:||.|||||||.||||:|.|.:.:|
Zfish   211 SDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQH 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 93/174 (53%)
ctdnep1bNP_001007441.2 HIF-SF_euk 65..233 CDD:274055 93/174 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D468474at33208
OrthoFinder 1 1.000 - - FOG0002783
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1870
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.