DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and ctdnep1a

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001007310.1 Gene:ctdnep1a / 492343 ZFINID:ZDB-GENE-041114-177 Length:245 Species:Danio rerio


Alignment Length:217 Identity:109/217 - (50%)
Similarity:142/217 - (65%) Gaps:10/217 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LRT---YLGLSYREVSVSQDMAHRLAVVGRKTLVLDLDETLVHSCYLDPDTHDNVGCSQLPEHAQ 130
            |||   |..:.|..:.:|....:||..|.||.|||||||||:||      .||.|....:.....
Zfish    33 LRTIIQYQTVRYDILPLSPISRNRLNAVKRKILVLDLDETLIHS------HHDGVLRPTVRPGTP 91

  Fly   131 PDYVLNISIDGMEPIVFRVFKRPHVDEFLDFVSKWYDLVIYTASLEVYAAQVVDHLDAGRGLITR 195
            ||::|.:.|| ..|:.|.|.||||||.||:.||:||:||::|||:|:|.:.|.|.||..||::.|
Zfish    92 PDFILKVVID-KHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNNRGILKR 155

  Fly   196 RFYRQHCRASSPMVSKDLTLVTPDMSGVLIIDNSPYAYRDFPDNAIPIKTFIYDPDDTELLKMLP 260
            |:|||||........|||::|..|:|.::|:||||.|||..||||||||::..||.||.||.:||
Zfish   156 RYYRQHCTLDLGSYIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLP 220

  Fly   261 FLDALRFTKDVRSILGRRVIRH 282
            .|||||||.||||:|.|.:.:|
Zfish   221 MLDALRFTSDVRSVLSRNLHQH 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 93/174 (53%)
ctdnep1aNP_001007310.1 HIF-SF_euk 62..230 CDD:274055 93/174 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 1 1.000 - - FOG0002783
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1870
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.