DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and timm50

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_956959.1 Gene:timm50 / 393638 ZFINID:ZDB-GENE-040426-1618 Length:387 Species:Danio rerio


Alignment Length:181 Identity:43/181 - (23%)
Similarity:80/181 - (44%) Gaps:33/181 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 TLVLDLDETLVHSCYLDPDTHDNVGCSQLPEHAQPDYVLNISIDGMEPIVFRVFKRPHVDEFLDF 161
            ||||:|.:.|:|                      |::.|...        :|..|||.:|.....
Zfish   184 TLVLELTDVLLH----------------------PEWSLATG--------WRFKKRPGIDYLFQQ 218

  Fly   162 VSKWYDLVIYTASLEVYAAQVVDHLDAGRGLITRRFYRQHCRASSPMVSKDLTLVTPDMSGVLII 226
            ::..|::||:|:...:.|..::|.:|. :|.:..|.:|...|.......||::.:..|.|.|:::
Zfish   219 LAPLYEIVIFTSETGMTAYPLIDSIDP-QGFVMYRLFRDATRYMEGHHVKDVSCLNRDTSKVIVV 282

  Fly   227 DNSPYAYRDFPDNAIPIKTFIYDPDDTELLKMLPFLDALRFT--KDVRSIL 275
            |....|:...|.|.:.:..:..:.:|..|..:..||..:..:  :||||:|
Zfish   283 DCKREAFGLQPFNGLALCKWDGNSEDRTLYDLAAFLKTIATSGVEDVRSVL 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 38/174 (22%)
timm50NP_956959.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..93
NIF 183..330 CDD:281081 39/176 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.