DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and Fcp1

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001286846.1 Gene:Fcp1 / 37925 FlyBaseID:FBgn0035026 Length:880 Species:Drosophila melanogaster


Alignment Length:256 Identity:58/256 - (22%)
Similarity:101/256 - (39%) Gaps:41/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PSGQFAV--------AVVSNLQRSRSSSDRRGLVLILLS------------SDLGTYIRR-LLAR 60
            |.|..|:        .||....|.......:|..::.||            :|.|..:|: ...:
  Fly   105 PGGDCAIQRYKSQRAGVVKKRLRKEGELLTKGDAILELSECIHTTVIKDMCADCGADLRQNENGQ 169

  Fly    61 VAEKACTILRTYLGLSYREVSVSQDMAH----RLAVVGRKTLVLDLDETLVHSCYLDPDTHDNVG 121
            .:|.:..::.|...|...: .::|.:.|    ||....:..|::|||:|::|:      |:|.| 
  Fly   170 TSEASVPMVHTMPDLKVTQ-KLAQKLGHDDTRRLLADRKLVLLVDLDQTVIHT------TNDTV- 226

  Fly   122 CSQLPEHAQPDYVLNISIDGMEPIVFRVFKRPHVDEFLDFVSKWYDLVIYTASLEVYAAQVVDHL 186
                |::.:..|  :..:.|.....:....||...|||:.:|:.|:|.|.|.....||..:...|
  Fly   227 ----PDNIKGIY--HFQLYGPHSPWYHTRLRPGTAEFLERMSQLYELHICTFGARNYAHMIAQLL 285

  Fly   187 D-AGRGLITRRFYRQHCRASSPMVSKDLTLVTPDMSGVLIIDNSPYAYRDFPDNAIPIKTF 246
            | .|:....|...|..|..::........|.....|.|.|||:....: :...|.|.:|.:
  Fly   286 DPEGKFFSHRILSRDECFNATSKTDNLKALFPNGDSMVCIIDDREDVW-NMASNLIQVKPY 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 39/153 (25%)
Fcp1NP_001286846.1 Biotinyl_lipoyl_domains 59..142 CDD:299706 7/36 (19%)
FCP1_euk 202..348 CDD:131304 40/158 (25%)
COG5275 481..>658 CDD:227600
BRCT 587..665 CDD:278934
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.