DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and ttm3

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_610130.1 Gene:ttm3 / 35437 FlyBaseID:FBgn0032971 Length:343 Species:Drosophila melanogaster


Alignment Length:237 Identity:61/237 - (25%)
Similarity:97/237 - (40%) Gaps:63/237 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 ILRTYLGLSYREVSVSQDMAHRLA--------VVGRKTLVLDLDETLVHSCYLDPDTHDNVGCSQ 124
            |:|.:..|.|.|..:.:....||.        :....:|||::.:.|||                
  Fly   104 IMRMWHTLQYYEKMMEEPQMARLLPNVVPPPYIQPPYSLVLEIKDVLVH---------------- 152

  Fly   125 LPEHAQPDYVLNISIDGMEPIVFRVFKRPHVDEFLDFVSKWYDLVIYTASLEVYAAQVVDHLDAG 189
                  ||:.....        :|..|||.||.||...|:.:::||||:...:.|..::|.||. 
  Fly   153 ------PDWTYQTG--------WRFKKRPGVDYFLQQCSRNFEIVIYTSEQGMTAFPLLDALDP- 202

  Fly   190 RGLITRRFYR--------QHCRASSPMVSKDLTLVTPDMSGVLIIDNSPYAYRDFPDNAIPIKTF 246
            .|.|..|..|        ||        :|:|..:..|:|.|:::|..||.....|||::.:..:
  Fly   203 YGYIKYRLVRGATDLVEGQH--------TKNLDYLNRDLSRVIVVDCDPYTTPLHPDNSLVLTKW 259

  Fly   247 IYDPDDTELLKMLPFLD--ALRFTKDVRSILGRRVIRHYYNR 286
            :.:.||.:|..:..||.  |.....|||.:|      .||.:
  Fly   260 LGNDDDVQLFDLTAFLQLIAEHQVNDVREVL------RYYRQ 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 48/184 (26%)
ttm3NP_610130.1 CPDc 138..265 CDD:214729 42/165 (25%)
HIP1_clath_bdg 276..332 CDD:293123 7/26 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461642
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.