DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and Dd

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_608449.1 Gene:Dd / 33107 FlyBaseID:FBgn0029067 Length:243 Species:Drosophila melanogaster


Alignment Length:246 Identity:116/246 - (47%)
Similarity:152/246 - (61%) Gaps:23/246 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LILLSSDLGTYI-----RRLLARVAEKACTILRTYLGLSYREVSVSQDMAHRLAVVGRKTLVLDL 102
            |:||.|.:.|.|     |::.|.:         .|..:.|....:|....|||::|.||||||||
  Fly    12 LLLLLSKVWTCICFMFNRQVRAFI---------QYQPVKYELFPLSPVSRHRLSLVQRKTLVLDL 67

  Fly   103 DETLVHSCYLDPDTHDNVGCSQLPEHAQP-DYVLNISIDGMEPIVFRVFKRPHVDEFLDFVSKWY 166
            ||||:||       |.|.......:...| |:.:.::|| ..|:.|.|.||||||.|||.||:||
  Fly    68 DETLIHS-------HHNAMPRNTVKPGTPHDFTVKVTID-RNPVRFFVHKRPHVDYFLDVVSQWY 124

  Fly   167 DLVIYTASLEVYAAQVVDHLDAGRGLITRRFYRQHCRASSPMVSKDLTLVTPDMSGVLIIDNSPY 231
            |||::|||:|:|.|.|.|.||.||.::.||:|||||.......:|||:.:..|::.:.||||||.
  Fly   125 DLVVFTASMEIYGAAVADKLDNGRNILRRRYYRQHCTPDYGSYTKDLSAICSDLNRIFIIDNSPG 189

  Fly   232 AYRDFPDNAIPIKTFIYDPDDTELLKMLPFLDALRFTKDVRSILGRRVIRH 282
            |||.||:||||||::..||.||.||.:||.|||||||.||||:|.|.:..|
  Fly   190 AYRCFPNNAIPIKSWFSDPMDTALLSLLPMLDALRFTNDVRSVLSRNLHLH 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 94/175 (54%)
DdNP_608449.1 HIF-SF_euk 60..228 CDD:274055 94/175 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468338
Domainoid 1 1.000 159 1.000 Domainoid score I998
eggNOG 1 0.900 - - E1_COG5190
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S856
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102985at50557
OrthoFinder 1 1.000 - - FOG0002783
OrthoInspector 1 1.000 - - mtm1004
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1870
109.800

Return to query results.
Submit another query.