DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and Ctdspl2

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:XP_038960896.1 Gene:Ctdspl2 / 311368 RGDID:1309219 Length:478 Species:Rattus norvegicus


Alignment Length:211 Identity:72/211 - (34%)
Similarity:118/211 - (55%) Gaps:27/211 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 VSQDMAHRLAVVGRKT-------LVLDLDETLVHSCYLDPDTHDNVGCSQLPEHAQPDYVLNISI 139
            ::::..:|...:..||       ||||||||||| |.|          ::|.:.|....||    
  Rat   279 LTEEQLNRKPALPLKTRSTPEFSLVLDLDETLVH-CSL----------NELEDAALTFPVL---- 328

  Fly   140 DGMEPIVFRVF--KRPHVDEFLDFVSKWYDLVIYTASLEVYAAQVVDHLDAGRGLITRRFYRQHC 202
              .:.::::|:  .||...|||:.:|:.|:::::|||.:|||.::::.||..:.|:..|.:|:||
  Rat   329 --FQDVIYQVYVRLRPFFREFLERMSQMYEIILFTASKKVYADKLLNILDPKKQLVRHRLFREHC 391

  Fly   203 RASSPMVSKDLTLVTPDMSGVLIIDNSPYAYRDFPDNAIPIKTFIYDPDDTELLKMLPFLDAL-R 266
            ........|||.::..|:|..:||||||.|:.....|.|||:::..|.:|.||||::|||:.| .
  Rat   392 VCVQGNYIKDLNILGRDLSKTIIIDNSPQAFAYQLSNGIPIESWFMDKNDNELLKLIPFLEKLVE 456

  Fly   267 FTKDVRSILGRRVIRH 282
            ..:|||..:..|...|
  Rat   457 LNEDVRPHIRDRFRLH 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 66/184 (36%)
Ctdspl2XP_038960896.1 HIF-SF_euk 299..460 CDD:274055 64/177 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.