DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and Ctdspl

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001382669.1 Gene:Ctdspl / 301056 RGDID:1304841 Length:276 Species:Rattus norvegicus


Alignment Length:184 Identity:70/184 - (38%)
Similarity:106/184 - (57%) Gaps:16/184 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 GRKTLVLDLDETLVHSCYLDPDTHDNVGCSQLPEHAQPDYVLNISIDGMEPIVFRVFKRPHVDEF 158
            |:|.:|:|||||||||.:              ...:..|:::.:.|||....|: |.||||||||
  Rat   105 GKKCVVIDLDETLVHSSF--------------KPISNADFIVPVEIDGTIHQVY-VLKRPHVDEF 154

  Fly   159 LDFVSKWYDLVIYTASLEVYAAQVVDHLDAGRGLITRRFYRQHCRASSPMVSKDLTLVTPDMSGV 223
            |..:.:.::.|::||||..||..|.|.||.. |:...|.:|:.|........|||:.:..::|.|
  Rat   155 LQRMGQLFECVLFTASLAKYADPVADLLDRW-GVFRARLFRESCVFHRGNYVKDLSRLGRELSKV 218

  Fly   224 LIIDNSPYAYRDFPDNAIPIKTFIYDPDDTELLKMLPFLDALRFTKDVRSILGR 277
            :|:||||.:|...|:||:|::::..|..|||||.::||.:.|....||..:|.|
  Rat   219 IIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSREDDVYRMLHR 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 65/174 (37%)
CtdsplNP_001382669.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.