DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and nem1

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_596404.1 Gene:nem1 / 2541021 PomBaseID:SPBC3B8.10c Length:476 Species:Schizosaccharomyces pombe


Alignment Length:210 Identity:80/210 - (38%)
Similarity:125/210 - (59%) Gaps:16/210 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LSYREVSVSQDMAHRLAV---VGRKTLVLDLDETLVHSCYLDPDTHDNVGCSQLPEHAQPDYVLN 136
            |..|.:::..|...|..:   :.||||||||||||:||          |.........||   :.
pombe   280 LRIRNITLCADKIPRPLLNSKLPRKTLVLDLDETLIHS----------VSRGSRTTSGQP---IE 331

  Fly   137 ISIDGMEPIVFRVFKRPHVDEFLDFVSKWYDLVIYTASLEVYAAQVVDHLDAGRGLITRRFYRQH 201
            :.:.|..||::.:.||||:|.||..||:|:.|:::|||::.||..::|:|:..:.:..:|:||||
pombe   332 VHVPGEHPILYYIHKRPHLDYFLSNVSQWFRLILFTASVQPYADPIIDYLERDKKIFAKRYYRQH 396

  Fly   202 CRASSPMVSKDLTLVTPDMSGVLIIDNSPYAYRDFPDNAIPIKTFIYDPDDTELLKMLPFLDALR 266
            |........||:::....:|.::||||||.:|....:|||||:.:|.||.|.:||.:|.||.||:
pombe   397 CALVDSSFVKDISICNIHLSRIMIIDNSPASYNAHKENAIPIEGWISDPSDVDLLNLLSFLHALQ 461

  Fly   267 FTKDVRSILGRRVIR 281
            :..|||.:||.|:.:
pombe   462 YVHDVRDLLGLRLAK 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 70/174 (40%)
nem1NP_596404.1 FCP1 43..476 CDD:227517 80/208 (38%)
HAD_like 303..465 CDD:304363 70/174 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 159 1.000 Domainoid score I998
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002783
OrthoInspector 1 1.000 - - otm47111
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1870
TreeFam 1 0.960 - -
87.870

Return to query results.
Submit another query.