DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and CTDNEP1

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001137247.1 Gene:CTDNEP1 / 23399 HGNCID:19085 Length:244 Species:Homo sapiens


Alignment Length:239 Identity:111/239 - (46%)
Similarity:153/239 - (64%) Gaps:11/239 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 ILLSSDLGTYIRRLLARVAEKACTILRTYLGLSYREVSVSQDMAHRLAVVGRKTLVLDLDETLVH 108
            :..::.|.::...||.|   :..|::: |..:.|..:.:|....:|||.|.||.|||||||||:|
Human    14 VAFAAKLWSFFIYLLRR---QIRTVIQ-YQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETLIH 74

  Fly   109 SCYLDPDTHDNVGCSQLPEHAQPDYVLNISIDGMEPIVFRVFKRPHVDEFLDFVSKWYDLVIYTA 173
            |      .||.|....:.....||::|.:.|| ..|:.|.|.||||||.||:.||:||:||::||
Human    75 S------HHDGVLRPTVRPGTPPDFILKVVID-KHPVRFFVHKRPHVDFFLEVVSQWYELVVFTA 132

  Fly   174 SLEVYAAQVVDHLDAGRGLITRRFYRQHCRASSPMVSKDLTLVTPDMSGVLIIDNSPYAYRDFPD 238
            |:|:|.:.|.|.||..|.::.||:|||||........|||::|..|:|.::|:||||.|||..||
Human   133 SMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKDLSVVHSDLSSIVILDNSPGAYRSHPD 197

  Fly   239 NAIPIKTFIYDPDDTELLKMLPFLDALRFTKDVRSILGRRVIRH 282
            ||||||::..||.||.||.:||.|||||||.||||:|.|.:.:|
Human   198 NAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQH 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 92/174 (53%)
CTDNEP1NP_001137247.1 HIF-SF_euk 61..229 CDD:274055 92/174 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 1 1.000 - - FOG0002783
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1870
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.980

Return to query results.
Submit another query.