DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and Ctdsp1

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:XP_036020359.1 Gene:Ctdsp1 / 227292 MGIID:2654470 Length:302 Species:Mus musculus


Alignment Length:219 Identity:70/219 - (31%)
Similarity:101/219 - (46%) Gaps:57/219 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LVLDLDETLVHSCYLDPDTHDNVGCSQLPEHAQPDYVLNISIDG--------------------- 141
            :|:|||||||||.:...:              ..|:::.:.|||                     
Mouse    93 VVIDLDETLVHSSFKPVN--------------NADFIIPVEIDGVVHQEWGMVGAASLDCPSSST 143

  Fly   142 --------------------MEPIVFRVFKRPHVDEFLDFVSKWYDLVIYTASLEVYAAQVVDHL 186
                                :.|.|: |.|||||||||..:.:.::.|::||||..||..|.|.|
Mouse   144 VPVPLLWITPKPVGQQLPHWLVPQVY-VLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLL 207

  Fly   187 DAGRGLITRRFYRQHCRASSPMVSKDLTLVTPDMSGVLIIDNSPYAYRDFPDNAIPIKTFIYDPD 251
            |.. |....|.:|:.|........|||:.:..|:..|||:||||.:|...||||:|:.::..:..
Mouse   208 DKW-GAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMS 271

  Fly   252 DTELLKMLPFLDALRFTKDVRSIL 275
            ||||..:|||.:.|....||.|:|
Mouse   272 DTELHDLLPFFEQLSRVDDVYSVL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 66/212 (31%)
Ctdsp1XP_036020359.1 HIF-SF_euk 90..290 CDD:274055 66/212 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.