DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and cnep-1

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001254123.1 Gene:cnep-1 / 185802 WormBaseID:WBGene00018474 Length:276 Species:Caenorhabditis elegans


Alignment Length:282 Identity:115/282 - (40%)
Similarity:154/282 - (54%) Gaps:40/282 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PSGQFAVAVVSNLQRSRSSSDRRGLVLILLSSDLGTYIRRLLARVAEKACTILRTYLG---LSYR 78
            |:.||.    .....|....|::...|:|          |.:..:|:.....|..:..   |.:|
 Worm     4 PNRQFG----GGNPESHRRRDQKQASLVL----------RTMTTIAQSVFCFLAGFFNFFLLYFR 54

  Fly    79 EVS----------------VSQDMAHRLAVVGRKTLVLDLDETLVHSCYLDPDTHDNVGCSQLPE 127
            :.|                :|....|||..|.||.|||||||||:||      .||.|....:..
 Worm    55 KTSRAYCKYQVVKYHSNIPMSPLTTHRLLTVKRKILVLDLDETLIHS------HHDGVLRQTVKP 113

  Fly   128 HAQPDYVLNISIDGMEPIVFRVFKRPHVDEFLDFVSKWYDLVIYTASLEVYAAQVVDHLDAGRGL 192
            ....|:.:.:.|| ..|:.|.|.:|||||.||..||:||:||::|||:|||...|.|.||.|||:
 Worm   114 GTPSDFTIRVVID-RHPVKFSVHERPHVDYFLSVVSQWYELVVFTASMEVYGTSVADRLDRGRGI 177

  Fly   193 ITRRFYRQHCRASSPMVSKDLTLVTPDMSGVLIIDNSPYAYRDFPDNAIPIKTFIYDPDDTELLK 257
            :.||::||||.......:|||:.:.||:|.:.|:||||.|||.||.|||||.::..||:||.||.
 Worm   178 LKRRYFRQHCTMEVGGYTKDLSAIHPDLSSICILDNSPGAYRKFPHNAIPIPSWFSDPNDTCLLN 242

  Fly   258 MLPFLDALRFTKDVRSILGRRV 279
            :||||||||||.||||:|.|.:
 Worm   243 LLPFLDALRFTSDVRSVLSRNM 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 91/174 (52%)
cnep-1NP_001254123.1 HIF-SF_euk 87..255 CDD:274055 91/174 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S856
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 1 1.000 - - FOG0002783
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1870
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.