DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and scpl-1

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_740912.2 Gene:scpl-1 / 181944 WormBaseID:WBGene00007054 Length:491 Species:Caenorhabditis elegans


Alignment Length:171 Identity:71/171 - (41%)
Similarity:101/171 - (59%) Gaps:16/171 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 RKTLVLDLDETLVHSCYLDPDTHDNVGCSQLPEHAQPDYVLNISIDGMEPIVFRVFKRPHVDEFL 159
            :|.||:|||||||||.:              .....||:|:.:.|||:|..|: |.|||:|||||
 Worm   311 KKCLVIDLDETLVHSSF--------------KPVKNPDFVIPVEIDGVEHQVY-VLKRPYVDEFL 360

  Fly   160 DFVSKWYDLVIYTASLEVYAAQVVDHLDAGRGLITRRFYRQHCRASSPMVSKDLTLVTPDMSGVL 224
            ..|.:.::.:::||||..||..|.|.||..| :...|.:|:.|........|||:.:..:::..|
 Worm   361 AKVGEHFECILFTASLAKYADPVADLLDKKR-VFRGRLFREACVFHKGNYVKDLSRLGRNLNQTL 424

  Fly   225 IIDNSPYAYRDFPDNAIPIKTFIYDPDDTELLKMLPFLDAL 265
            ||||||.:|...|:||:|:.|:..||.|||||.:||.|:.|
 Worm   425 IIDNSPASYAFHPENAVPVTTWFDDPSDTELLDILPSLEHL 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 71/171 (42%)
scpl-1NP_740912.2 HIF-SF_euk 311..465 CDD:274055 70/169 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.