DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and scpl-4

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_505722.1 Gene:scpl-4 / 179481 WormBaseID:WBGene00011897 Length:452 Species:Caenorhabditis elegans


Alignment Length:197 Identity:51/197 - (25%)
Similarity:86/197 - (43%) Gaps:48/197 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 TLVLDLDETLVHSCYLDPDTHDNVGCSQLPEHAQPDYVLNISIDGMEPIVFRVFKRPHVDEFLDF 161
            |:|::|...|||                      |::.....        :|..|||.:|.|||.
 Worm   249 TIVIELKNILVH----------------------PEWTYKTG--------YRFLKRPALDYFLDV 283

  Fly   162 VS-KWYDLVIYTASLEVYAAQVVDHLDAGRGLITRRFYRQHCRASSPMVSKDLTLVTPDMSGVLI 225
            :. ..:::|||::...:.||.|||..|. :..|..:.:|...:..:....|||:.:..|:|.|:.
 Worm   284 IGYPNFEVVIYSSESMMTAAPVVDSFDP-KQRIMYKLFRDCTKYMNGHHVKDLSKLNRDLSKVIY 347

  Fly   226 IDNSPYAYRDFPDNAIPIKTFIYDPDDT------ELLKMLPFLDALRFTKDVRSILGRRVIRHYY 284
            ||....:.:..|:|.:.:..:..:.|||      ||||.:...||    :|||.:|      .||
 Worm   348 IDFDAKSGQLNPENMLRVPEWKGNMDDTSLVDLAELLKTIHLSDA----EDVRPML------QYY 402

  Fly   285 NR 286
            ::
 Worm   403 SQ 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 45/179 (25%)
scpl-4NP_505722.1 NIF 248..396 CDD:281081 46/181 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.