DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and fcp-1

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_492423.2 Gene:fcp-1 / 172719 WormBaseID:WBGene00009479 Length:659 Species:Caenorhabditis elegans


Alignment Length:183 Identity:45/183 - (24%)
Similarity:75/183 - (40%) Gaps:46/183 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 EVSVSQDMAHRLA-------VVGRK-TLVLDLDETLVHS----CYLDPDTHDNVGCSQLPEHAQP 131
            |:.||..:|..:.       :..|| .|::|||:|::|:    ..:|.:.|.::....|  |:: 
 Worm   119 ELIVSDTLAKEIGSADENNLITNRKLVLLVDLDQTIIHTSDKPMTVDTENHKDITKYNL--HSR- 180

  Fly   132 DYVLNISIDGMEPIVFRVFKRPHVDEFLDFVSKWYDLVIYTASLEVYAAQVVDHLDAGRGLITRR 196
                          |:....|||..|||:.:|..|::.|.|.....||.::...||....|..:|
 Worm   181 --------------VYTTKLRPHTTEFLNKMSNMYEMHIVTYGQRQYAHRIAQILDPDARLFEQR 231

  Fly   197 -------FYRQH----CRASSPMVSKDLTLVTPDMSGV-----LIIDNSPYAY 233
                   |..||    .:|..| ...:|.::..|.|.|     .:|...||.:
 Worm   232 ILSRDELFSAQHKTNNLKALFP-CGDNLVVIIDDRSDVWMYSEALIQIKPYRF 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 41/160 (26%)
fcp-1NP_492423.2 HAD_like 138..284 CDD:328728 41/164 (25%)
BRCT 358..431 CDD:237994
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.