DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and scpl-3

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001379798.1 Gene:scpl-3 / 172032 WormBaseID:WBGene00021629 Length:287 Species:Caenorhabditis elegans


Alignment Length:196 Identity:74/196 - (37%)
Similarity:107/196 - (54%) Gaps:35/196 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 TLVLDLDETLVHSCYLDPDTHDNVGCSQLPEHAQPDYVLNISIDGMEPIVFR-------VFKRPH 154
            |||||||||||| |.|.|  .||...                   :.|:||:       |..|||
 Worm    66 TLVLDLDETLVH-CSLTP--LDNATM-------------------VFPVVFQNITYQVYVRLRPH 108

  Fly   155 VDEFLDFVSKWYDLVIYTASLEVYAAQVVDHLDAGRGLITRRFYRQHCRASSPMVSKDLTLVTPD 219
            :..||..::|.::::|:|||.:|||.::.|.||..:..|..|.:|:||........||||::..|
 Worm   109 LRTFLSRMAKTFEIIIFTASKKVYANKLCDILDPRKNHIRHRLFREHCVCVFGNYVKDLTILGRD 173

  Fly   220 MSGVLIIDNSPYAYRDFPDNAIPIKTFIYDPDDTELLKMLPFLDAL-RFTKDVRSILGRRVIRHY 283
            .|..:|:||:..::....||.|||:::.:|.:||||||:..||:|: ...:|||.||     ||.
 Worm   174 PSKTMILDNAVQSFAYQLDNGIPIESWFHDRNDTELLKLCSFLEAIPTLGRDVREIL-----RHK 233

  Fly   284 Y 284
            |
 Worm   234 Y 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 66/180 (37%)
scpl-3NP_001379798.1 HIF-SF_euk 66..220 CDD:274055 66/175 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.