DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and XB5962940

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:XP_002941162.1 Gene:XB5962940 / 100486858 XenbaseID:XB-GENE-5962941 Length:353 Species:Xenopus tropicalis


Alignment Length:215 Identity:58/215 - (26%)
Similarity:98/215 - (45%) Gaps:23/215 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 CTILRTYLGLSYREVSVSQDMAHRLAVVGRKTLVLDLDETLVHSCYLDPDTHDNVGCSQLPEHAQ 130
            |.|.:|......|    .:|:..:.......||||||||.||.|             |.|| ...
 Frog   150 CNIQQTPCDQRQR----GKDIPFKTRSAPESTLVLDLDEILVDS-------------SLLP-LTG 196

  Fly   131 PDYVLNISIDGMEPIVFRVF--KRPHVDEFLDFVSKWYDLVIYTASLEVYAAQVVDHLDAGRGLI 193
            .|:...|.   .:...::|:  .|||..|||:.:.|.|::.::|.:.:.||.:::|.||..:.||
 Frog   197 ADFTFLIP---FQDTYYKVYVKLRPHAMEFLETLCKVYEIFVFTTAKKEYAEKILDLLDPQKKLI 258

  Fly   194 TRRFYRQHCRASSPMVSKDLTLVTPDMSGVLIIDNSPYAYRDFPDNAIPIKTFIYDPDDTELLKM 258
            ..|.::..|........|||.::..|::..:.:|.:|:.......|.|||:::.....|..||.:
 Frog   259 RHRLFQDQCLCVEGHYVKDLGILQRDLAKTVALDTAPHTIPYHLANRIPIQSWKGSKKDRGLLSL 323

  Fly   259 LPFLDALRFTKDVRSILGRR 278
            |..|:.:....|||.::..:
 Frog   324 LSTLEKMTLVDDVRLVISHQ 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 50/176 (28%)
XB5962940XP_002941162.1 NIF 177..337 CDD:367305 51/176 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.