DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and ctdsp1

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:XP_017953012.1 Gene:ctdsp1 / 100380164 XenbaseID:XB-GENE-984307 Length:260 Species:Xenopus tropicalis


Alignment Length:182 Identity:69/182 - (37%)
Similarity:103/182 - (56%) Gaps:16/182 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 GRKTLVLDLDETLVHSCYLDPDTHDNVGCSQLPEHAQPDYVLNISIDGMEPIVFRVFKRPHVDEF 158
            |:..:|:|||||||||.:...:              ..|:::.:.|:|....|: |.||||||||
 Frog    88 GKICVVIDLDETLVHSSFKPVN--------------NADFIIPVEIEGTVHQVY-VLKRPHVDEF 137

  Fly   159 LDFVSKWYDLVIYTASLEVYAAQVVDHLDAGRGLITRRFYRQHCRASSPMVSKDLTLVTPDMSGV 223
            |..:.:.::.|::||||..||..|.|.||.. |....|.:|:.|........|||:.:..|::.:
 Frog   138 LRRMGEMFECVLFTASLAKYADPVADLLDKW-GAFRSRLFRESCAFHRGNYVKDLSRLGRDLNKL 201

  Fly   224 LIIDNSPYAYRDFPDNAIPIKTFIYDPDDTELLKMLPFLDALRFTKDVRSIL 275
            :||||||.:|...||||:|:.::..|..|||||.:|||.:.:....||.|:|
 Frog   202 IIIDNSPASYIFHPDNAVPVASWFDDMTDTELLDLLPFFERISRMDDVYSVL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 64/174 (37%)
ctdsp1XP_017953012.1 HIF-SF_euk 89..248 CDD:274055 64/174 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.