DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and prss60.1

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:285 Identity:89/285 - (31%)
Similarity:136/285 - (47%) Gaps:43/285 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 LKGCGYSNPKGLYYQLDGYNN----GESVF-AEFPWMVAL-MDMEGNFVCGGTLIHPQLVLTSAH 243
            |..||          |...||    |.:.| ..:||.|:| ..:.|...|||:||:.:.|||:||
Zfish    22 LNVCG----------LAPLNNRIVGGVNAFDGSWPWQVSLHSPIYGGHFCGGSLINSEWVLTAAH 76

  Fly   244 NVFNRSEDSLLVRAGDWDLNSQTELHPYQM-RAISELHRHENFNNLTLYNDIALVVLERPFQVAP 307
            .:...:..||||..|.   .:|..::.|:: |.:|.:..|.::||||..|||||:.|......:.
Zfish    77 CLPRITTSSLLVFLGK---TTQQGVNTYEINRTVSVITVHPSYNNLTNENDIALLHLSSAVTFSN 138

  Fly   308 HIQPICLPPPETPQMEAELRSASCLATGWG-LRYSTSRTMENLLKRIELPAVDHESCQRLLRHTV 371
            :|:|:||    ..|........|...|||| ::...:.....:|:...:|.|.::.|..||..  
Zfish   139 YIRPVCL----AAQNSVFPNGTSSWITGWGNIQLGVNLPAPGILQETMIPVVPNDQCNALLGS-- 197

  Fly   372 LGRRYNLHPSFTCAGGVK-GKDTCMGDGGSPLF---CTLPGQKDRYQLVGLVSWGIECAEKDVPA 432
             |...|   :..|||.:: |:|||.||.|.|:.   |.:..|.      |:.|||..||:...|.
Zfish   198 -GSVTN---NMICAGLLQGGRDTCQGDSGGPMVSKQCLVWVQS------GITSWGYGCADPYSPG 252

  Fly   433 AYTNVAYLRNWIDEQVTKS--GFPL 455
            .||.|:..::||:..:.::  ||.|
Zfish   253 VYTRVSQYQSWINSIIVQNLPGFVL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 79/247 (32%)
Tryp_SPc 207..444 CDD:214473 77/244 (32%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 78/249 (31%)
Tryp_SPc 34..267 CDD:238113 80/251 (32%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587388
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.