DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and Prss41

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:XP_036016678.1 Gene:Prss41 / 71003 MGIID:1918253 Length:353 Species:Mus musculus


Alignment Length:282 Identity:79/282 - (28%)
Similarity:121/282 - (42%) Gaps:78/282 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 ESVFAEFPWMVALMDMEGNFVCGGTLIHPQLVLTSAH----------------------NVFNRS 249
            ||:...:||..:|. ::.:..|||:|:..:.|||:||                      :.:||.
Mouse    89 ESMQGRWPWQASLR-LKKSHRCGGSLLSRRWVLTAAHCFRKYLDPEKWTVQLGQLTSKPSYWNRK 152

  Fly   250 EDSLLVRAGDWDLNSQTELHPYQMRAISELHRHENFNNLTLYNDIALVVLERPFQVAPHIQPICL 314
            ..|...|..|..:||:.:|..:                     |:||:.|.........|||:|:
Mouse   153 AYSGRYRVKDIIVNSEDKLKSH---------------------DLALLRLASSVTYNKDIQPVCV 196

  Fly   315 PPPE-TPQMEAELRSASCLATGWGLRYSTSRTMENL--------LKRIELPAVDHESCQRLLRHT 370
            .|.. |.|.:..     |..||||:      ..|:|        |:.:::..:::..||.|.   
Mouse   197 QPSTFTSQHQPR-----CWVTGWGV------LQEDLKPLPPPYHLREVQVSILNNSRCQELF--- 247

  Fly   371 VLGRRYNLHPSFT----CAGGVKGK-DTCMGDGGSPLFCTLPGQKDRYQLVGLVSWGIECAEKDV 430
               ..::||...|    |||...|. |||.||.|.||.|.:.|.  .|| :|:|||||.|...::
Mouse   248 ---EIFSLHHLITKDVFCAGAEDGSADTCSGDSGGPLVCNMDGL--WYQ-IGIVSWGIGCGRPNL 306

  Fly   431 PAAYTNVAYLRNWIDEQVTKSG 452
            |..||||::..|||:..:..:|
Mouse   307 PGIYTNVSHYYNWIETMMILNG 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 78/275 (28%)
Tryp_SPc 207..444 CDD:214473 76/272 (28%)
Prss41XP_036016678.1 Tryp_SPc 84..321 CDD:238113 77/273 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.