DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and TPSB2

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_077078.5 Gene:TPSB2 / 64499 HGNCID:14120 Length:275 Species:Homo sapiens


Alignment Length:288 Identity:92/288 - (31%)
Similarity:132/288 - (45%) Gaps:46/288 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 LLKGCGYSNP-KGLYYQLDGYNNG-ESVFAEFPWMVAL--MDMEGNFVCGGTLIHPQLVLTSAHN 244
            :|....|:.| .|...|..|...| |:..:::||.|:|  .|......|||:|||||.|||:||.
Human    11 VLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVRDRYWMHFCGGSLIHPQWVLTAAHC 75

  Fly   245 VFNRSEDSLLVRAGDWDLNSQTELHPYQMRAISELHRHENFNNLTLYNDIALVVLERPFQVAPHI 309
            |....:|...:|.   .|..|...:..|:..:|.:..|..|....:..||||:.||.|..|:.|:
Human    76 VGPDVKDLAALRV---QLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHV 137

  Fly   310 QPICLPP-PET--PQMEAELRSASCLATGWGLRYSTSRTMENL-LKRIELPAVDHESCQ------ 364
            ..:.||| .||  |.|       .|..||||...:..|..... ||::::|.:::..|.      
Human   138 HTVTLPPASETFPPGM-------PCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLG 195

  Fly   365 -------RLLRHTVLGRRYNLHPSFTCAGGVKGKDTCMGDGGSPLFCTLPGQKDRYQLVGLVSWG 422
                   |::|..:|           |||..: :|:|.||.|.||.|.:.|   .:...|:||||
Human   196 AYTGDDVRIVRDDML-----------CAGNTR-RDSCQGDSGGPLVCKVNG---TWLQAGVVSWG 245

  Fly   423 IECAEKDVPAAYTNVAYLRNWIDEQVTK 450
            ..||:.:.|..||.|.|..:||...|.|
Human   246 EGCAQPNRPGIYTRVTYYLDWIHHYVPK 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 83/258 (32%)
Tryp_SPc 207..444 CDD:214473 81/255 (32%)
TPSB2NP_077078.5 Tryp_SPc 31..268 CDD:238113 83/261 (32%)
Tryp_SPc 31..267 CDD:214473 82/260 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152801
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.