DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and CG18735

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster


Alignment Length:285 Identity:87/285 - (30%)
Similarity:136/285 - (47%) Gaps:27/285 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 LGDQI-EEGRNPIQRNVKDFLLKGCGYSNPKGLYYQLDGYNNGESVFAEFPWMVALMDMEGNFVC 228
            ||.:: .|..:|.:|...:.   .||..|.:   :::.|  ..|:...|:|||:.|| ..|||.|
  Fly    53 LGPEVPAEWSSPAKRECAEC---SCGNINTR---HRIVG--GQETEVHEYPWMIMLM-WFGNFYC 108

  Fly   229 GGTLIHPQLVLTSAHNVFNRSEDSLLVRAGDWDLNSQTELHPYQMRAISELHRHENFNNLTLYND 293
            |.:|::.|..||:||.|.......:.||.  .:.|.|........|.:|.:..|..::.....:|
  Fly   109 GASLVNDQYALTAAHCVNGFYHRLITVRL--LEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSD 171

  Fly   294 IALVVLERPFQVAPHIQPICLPPPETPQMEAELRSASCLATGWGLRYSTSRTMENLLKRIELPAV 358
            |||:....|.::...:.|:|:|.|     .......:.:.|||| ..|....:.:.|:.:|:|.:
  Fly   172 IALIRFNEPVRLGIDMHPVCMPTP-----SENYAGQTAVVTGWG-ALSEGGPISDTLQEVEVPIL 230

  Fly   359 DHESCQRLLRHTVLGRRYNLHPSFTCAGGVK--GKDTCMGDGGSPLFCTLPGQKDRYQLVGLVSW 421
            ..|.|    |::..|.. .:..:..|||.|:  |||:|.||.|.|:.  :.|..|.|||.|:|||
  Fly   231 SQEEC----RNSNYGES-KITDNMICAGYVEQGGKDSCQGDSGGPMH--VLGSGDAYQLAGIVSW 288

  Fly   422 GIECAEKDVPAAYTNVAYLRNWIDE 446
            |..||:.:.|..||.|....:||.|
  Fly   289 GEGCAKPNAPGVYTRVGSFNDWIAE 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 78/242 (32%)
Tryp_SPc 207..444 CDD:214473 75/238 (32%)
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 76/246 (31%)
Tryp_SPc 83..314 CDD:238113 79/249 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457473
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.