DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and Prss44

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:XP_008764869.1 Gene:Prss44 / 501060 RGDID:1560940 Length:373 Species:Rattus norvegicus


Alignment Length:243 Identity:76/243 - (31%)
Similarity:127/243 - (52%) Gaps:20/243 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 EFPWMVALMDMEGNFVCGGTLIHPQLVLTSAHNVFNRSEDSLLVRAGDWDL-NSQTELHPYQMRA 275
            ::||.|:| .:....:|||:||....|:|:||.|:...:  .:|..|:.|| :|.:...|.|   
  Rat   123 KWPWQVSL-QVHKQHICGGSLISKWWVMTAAHCVYGHLD--YVVSMGEADLWSSMSVKIPVQ--- 181

  Fly   276 ISELHRHENFNNL-TLYNDIALVVLERPFQVAPHIQPICLPPPETPQMEAELRSASCLATGWGLR 339
              ::..|::::.: |:.:|||||:|..|...:.:|||:|:|..........|    |..||||..
  Rat   182 --DIIVHQDYSVMRTIVHDIALVLLAFPVNYSVNIQPVCIPEKSFLVQPGTL----CWVTGWGKT 240

  Fly   340 YSTSRTMENLLKRIELPAVDHESCQRLLRHTVLGRRYNL-HPSFTCAGGVKGKDTCMGDGGSPLF 403
            ....|: ..:|:.::|..:.||.|.::|: .:.||.:.| .....|....||.|.|.||.|.|:.
  Rat   241 IERGRS-SRVLREVDLSIIRHERCNQILK-DITGRIFTLVQEGGVCGYNKKGGDACQGDSGGPMV 303

  Fly   404 CTLPGQKDRYQLVGLVSWGIECAEKDVPAAYTNVAYLRNWIDEQVTKS 451
            |..   ...:..||:||||:.|.....|..||.|:|.|:||.::::::
  Rat   304 CEF---NKTWVQVGIVSWGLGCGRIGYPGIYTEVSYYRDWIIKELSRA 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 76/237 (32%)
Tryp_SPc 207..444 CDD:214473 74/234 (32%)
Prss44XP_008764869.1 Tryp_SPc 112..341 CDD:214473 74/234 (32%)
Tryp_SPc 113..341 CDD:238113 74/234 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 162 1.000 Domainoid score I3893
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.