DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and CG11313

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:349 Identity:103/349 - (29%)
Similarity:155/349 - (44%) Gaps:45/349 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 CVPRH--LCSTGVVNEDGRYIIKPR--INEESN--FGCRVVEECCPLGDQIEEGRNPIQRNVKDF 183
            |||.:  |..:...:.:.|:|.:.|  ::::|:  |.|     |.|..|.......|....:...
  Fly    40 CVPLNSVLAKSNPTDSEMRFIRESRCLVSDQSDLPFVC-----CTPDTDYNTTRARPNDEVIHST 99

  Fly   184 LLKGCGYSNPKGLYYQLDGYNNGESVFAEFPWMVAL--MDMEGNFV---CGGTLIHPQLVLTSAH 243
            ||...........|.|:...|  |:|..||.|||.|  ...:|..:   |.|:||:.:.|:|:||
  Fly   100 LLPDRSICGGDIAYNQITKGN--ETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAH 162

  Fly   244 NVF----NRSED---SLLVRAGDWD-------LNSQTELHPYQMRAISELHRHENFNNLTLYNDI 294
            .|.    .|..|   .:.||.|:.:       ||.:....|.|: |:.|:..||:|.....:|||
  Fly   163 CVSAATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQI-AVEEIRIHESFGTRLFWNDI 226

  Fly   295 ALVVLERPFQVAPHIQPICLPPPETPQMEAELRSASCLATGWGLRYSTSRTMENLLKRIELPAVD 359
            ||:.|.|....:|.|:|:||  |.|..::......:....||| |..||.:....:| :.:..|:
  Fly   227 ALIRLAREVAYSPSIRPVCL--PSTVGLQNWQSGQAFTVAGWG-RTLTSESSPVKMK-LRVTYVE 287

  Fly   360 HESCQRLLRHTVLGRRYNLHPSFTCAGGVKGKDTCMGDGGSPLFCTLPGQKDRYQLVGLVSWGIE 424
            ...|:|.....|:     |..|..||.|....|:|.||.|.||.....|.   :.|.|:||:|:.
  Fly   288 PGLCRRKYASIVV-----LGDSHLCAEGRSRGDSCDGDSGGPLMAFHEGV---WVLGGIVSFGLN 344

  Fly   425 CAEKDVPAAYTNVAYLRNWIDEQV 448
            |..:..||.||||.....||.:.:
  Fly   345 CGSRFWPAVYTNVLSYETWITQNI 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 84/258 (33%)
Tryp_SPc 207..444 CDD:214473 82/255 (32%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855 10/42 (24%)
Tryp_SPc 116..367 CDD:238113 85/265 (32%)
Tryp_SPc 116..364 CDD:214473 83/262 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457300
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.