DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and CG9733

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:308 Identity:92/308 - (29%)
Similarity:140/308 - (45%) Gaps:41/308 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 GDQIEEGRNPIQRNVK---DFLL---KGCGYSNPKGLYYQLDGYNNGESVFAEFPWMVAL--MDM 222
            |:|....|.|.:::..   ..||   ..||....:...|  ||.:...:   ||||||.|  ...
  Fly   125 GNQPATSRTPFRKSSTSDGSSLLPQPPSCGGVGIRNRIY--DGQDTDVN---EFPWMVLLEYRRR 184

  Fly   223 EGN---FVCGGTLIHPQLVLTSAHNVFNRSEDS----LLVRAGDWDLNSQTELHP--------YQ 272
            .||   ..|.|:||:.:.|||:||.:..|.|..    :.||.|:.|..:..:..|        .|
  Fly   185 SGNGLSTACAGSLINRRYVLTAAHCLTGRIEREVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQ 249

  Fly   273 MRAISELHRHENFNN--LTLYNDIALVVLERPFQVAPHIQPICLPPPETPQMEAELRSASCLATG 335
            .....|:..||.::.  ....:||.|:.:||..:.:.:||||||  |.:..:|:..........|
  Fly   250 RLGFEEIRVHERYSEKASNQVHDIGLIRMERNVRYSDNIQPICL--PSSVGLESRQSGQQFTVAG 312

  Fly   336 WGLRYSTSRTMENLLKRIELPAVDHESCQRLLRHTVLGRRYNLHPSFTCAGGVKGKDTCMGDGGS 400
            ||.....:|:.  :.:::.:..||...|::.....    :.||.|:..||||...||:|.||.|.
  Fly   313 WGRTLKMARSA--VKQKVTVNYVDPAKCRQRFSQI----KVNLEPTQLCAGGQFRKDSCDGDSGG 371

  Fly   401 PLFCTLPGQKDRYQLVGLVSWGIECAEKDVPAAYTNVAYLRNWIDEQV 448
            ||   :..:.:.:.|.|:||:|.:|..||.|..|||||....||.:.|
  Fly   372 PL---MRFRDESWVLEGIVSFGYKCGLKDWPGVYTNVAAYDIWIRQNV 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 80/258 (31%)
Tryp_SPc 207..444 CDD:214473 78/255 (31%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 81/266 (30%)
Tryp_SPc 162..415 CDD:238113 83/268 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457294
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.