DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and CG7142

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:251 Identity:71/251 - (28%)
Similarity:120/251 - (47%) Gaps:29/251 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 PWMVALMDMEGN----FVCGGTLIHPQLVLTSAHNVFNRS--EDSLLVRAGDWDLNSQT-ELHPY 271
            |::|::..|..:    ..|.||:|:...:||:||.:.:..  |:|::| ||..|::.|. |....
  Fly    92 PYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIV-AGSHDIHDQKGEASNI 155

  Fly   272 QMRAISELHRHENFNNLTLYNDIALVVLERPFQVAPHIQPICLPPPETPQMEAELRSASCLATGW 336
            |||.|....|||.:.......||||:..:.|.....::||..|     |:.:|:......| .||
  Fly   156 QMRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATL-----PEQDAQPEGYGTL-YGW 214

  Fly   337 GLRYSTSRT----MENLLKRIELPAVDHESCQRLLRHTVLGRRYNLHPSFTCAGGVK-GKDTCMG 396
            |   :.|.|    ..:.|:...:|.:|.|.|:::|..:.|    .||.:..|.|.:. |...|..
  Fly   215 G---NVSMTAVPNYPHRLQEANMPILDMELCEQILARSGL----PLHETNLCTGPLTGGVSICTA 272

  Fly   397 DGGSPLF--CTLPGQKDRYQLVGLVSWG-IECAEKDVPAAYTNVAYLRNWIDEQVT 449
            |.|.||.  |.....:....::|:|||| :.|.:|:.|:.:..|:....||::.::
  Fly   273 DSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVIS 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 71/247 (29%)
Tryp_SPc 207..444 CDD:214473 69/244 (28%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 71/247 (29%)
Tryp_SPc 84..323 CDD:214473 69/244 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.