DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and CG31266

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:259 Identity:67/259 - (25%)
Similarity:112/259 - (43%) Gaps:46/259 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 GESVFAE--FPWMVALMDMEGNFVCGGTLIHPQLVLTSAHNVFNRSEDSLLVRAGD---WDLNSQ 265
            |.:..||  :||:.::.:.....:||..::....|||:|..|......:|||..|.   |||.: 
  Fly    54 GGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWWDLYA- 117

  Fly   266 TELHPYQMRAISELHRHENFNNLTLYNDIALVVLERPFQVAPHIQPICLPPPETPQMEAELRSAS 330
                ||.  .:|::|.|.||:....:|||||:.|....:.....:.|.|...:      ||....
  Fly   118 ----PYY--TVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADID------ELEEGD 170

  Fly   331 CLA-TGWGLRYSTSRTMENLLKRIE------LPAVDHESCQRLLRHTVLGRRYNLHPSFTCAGGV 388
            .|. .|||    :|..|....:.::      ||.   ::|:..|::     :.::.....|....
  Fly   171 KLTFAGWG----SSEAMGTYGRYLQEASGTYLPV---DACREKLQN-----QDDVDLGHVCVQMD 223

  Fly   389 KGKDTCMGDGGSPLFCTLPGQKDRYQLVGLVSWGIECAEKDVPAAYTNVAYLRNWIDEQVTKSG 452
            .|:..|.||.|.||.      .::.:|||:.:||:.|. :..|..|...|:..:||  :.|.:|
  Fly   224 AGQGACHGDTGGPLI------DEQQRLVGIGNWGVPCG-RGYPDVYARTAFYHDWI--RTTMNG 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 64/251 (25%)
Tryp_SPc 207..444 CDD:214473 62/248 (25%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 63/249 (25%)
Tryp_SPc 52..275 CDD:238113 65/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.