DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and CG17404

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_650165.2 Gene:CG17404 / 41482 FlyBaseID:FBgn0038001 Length:275 Species:Drosophila melanogaster


Alignment Length:269 Identity:70/269 - (26%)
Similarity:111/269 - (41%) Gaps:60/269 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 GESVFAEFPWMVALM-DMEGN--FVCGGTLIHPQLVLTSAHNVFNRSEDSLLVRAGDWDLN---S 264
            ||.|    |:.|:|. ...|.  ..|||::|.|..:||:||.....:...:.|.||...||   |
  Fly    44 GEHV----PYQVSLQYRTRGGQMHFCGGSIIAPNRILTAAHCCQGLNASRMSVVAGIRGLNEKGS 104

  Fly   265 QTELHPYQMRAISELHRHENFNNLTLYNDIALVVLERPFQVAPHIQPICLPPPETPQMEA-ELRS 328
            ::::..|.:        |..:..| :.:|:|::.::.|.::            ....:.| |.||
  Fly   105 RSQVLSYSI--------HPKYQEL-VTSDLAVLSIKPPLKL------------NNSTISAIEYRS 148

  Fly   329 ---------ASCLATGWGLR------YSTSRTMENLLKRIELPAVDHESCQRLLRHTVLGRRYNL 378
                     .....||||||      :..:....|:|:|:....:.:..|:.....:|....   
  Fly   149 QGKDFVGGGVPVTLTGWGLRLPVPFPFLDNVNYPNVLQRMSYHTISNSECRNAGMESVTDTE--- 210

  Fly   379 HPSFTCAGGVKGKDTCMGDGGSPLFCTLPGQKDRYQLVGLVSWG-IECAEKDVPAAYTNVAYLRN 442
                .||.| ..:..|.||.|.||   :...|:..|.||:||:| :.|.....|..||.|:...:
  Fly   211 ----ICARG-PFRGACSGDSGGPL---VMESKNGLQQVGIVSYGLVVCGLYISPDVYTRVSTFSD 267

  Fly   443 WIDEQVTKS 451
            ||..| |||
  Fly   268 WIGNQ-TKS 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 65/262 (25%)
Tryp_SPc 207..444 CDD:214473 63/259 (24%)
CG17404NP_650165.2 Tryp_SPc 34..269 CDD:214473 64/260 (25%)
Tryp_SPc 35..269 CDD:238113 64/260 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.