DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and Prss46

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:XP_006244055.1 Gene:Prss46 / 408245 RGDID:1302970 Length:314 Species:Rattus norvegicus


Alignment Length:301 Identity:85/301 - (28%)
Similarity:136/301 - (45%) Gaps:63/301 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 CGYSNPKGL--------------------YYQLDGYN------NGESV-FAEFPWMVALMDMEGN 225
            ||..:|:||                    ::.....|      ||:.| ..::||.|:::.: |.
  Rat     3 CGSVDPQGLLSPPLSSARLSNVPHVEGPWFWSCGQTNISCKVVNGKVVEVGKWPWQVSILFL-GM 66

  Fly   226 FVCGGTLIHPQLVLTSAHNVFNRSED--SLLVRAGDWDL--NSQTELHPYQMRAISELHRHENFN 286
            ::|.|:|||...|||:|| ...||::  :..|:.|...|  ||.:||      .::.:..||||.
  Rat    67 YICSGSLIHHHWVLTAAH-CLQRSKNPANYTVKVGVQTLPDNSSSEL------LVTSIVIHENFI 124

  Fly   287 NLTLYNDIALVVLERPFQVAPHIQPICLPPPETPQMEAELR---SASCLATGWGLRYS-----TS 343
            | .:.:|||::.|:.|...:|.|||||||       |...:   ...|...||||..:     |.
  Rat   125 N-HMSHDIAILKLKYPVTWSPFIQPICLP-------EVNFKPSIGTMCWVIGWGLEKAKGAPKTP 181

  Fly   344 RTMENLLKRIELPAVDHESCQRLLRHTVL-GRRYNLHPSFTCAGGVKGKDTCMGDGGSPLFCTLP 407
            .:::.:..||    |::|.|....:..:| .::..:.....|.....|.|||....||.|.|.: 
  Rat   182 YSVQGVAVRI----VNNEICNHRYQFLLLKNQKKFIGNDMLCTSPEWGLDTCQDASGSSLVCQM- 241

  Fly   408 GQKDRYQLVGLVSWGIECAEKDVPAAYTNVAYLRNWIDEQV 448
             .|...|: |:|||...|..:..|:.||:.::...||..|:
  Rat   242 -NKTWIQM-GVVSWNFGCGRRQFPSIYTSTSHFTQWIKRQI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 76/253 (30%)
Tryp_SPc 207..444 CDD:214473 74/250 (30%)
Prss46XP_006244055.1 Tryp_SPc 43..276 CDD:214473 76/255 (30%)
Tryp_SPc 44..279 CDD:238113 78/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.