DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and Prss45

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001008864.1 Gene:Prss45 / 408244 RGDID:1303021 Length:330 Species:Rattus norvegicus


Alignment Length:256 Identity:74/256 - (28%)
Similarity:119/256 - (46%) Gaps:42/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 FPWMVALMDMEGNFVCGGTLIHPQLVLTSAHNVFNRSEDSLLVRAGDWDLNSQTELHPYQMR-AI 276
            :||.|:| .:|...||||.||....|:::||.:....|  .||..|...|  |....|:.:: .:
  Rat    61 WPWEVSL-QIENEHVCGGALIDQSWVVSAAHCIQGNKE--YLVMLGSSTL--QPSGSPWALKIPV 120

  Fly   277 SELHRH-----ENFNNLTLYNDIALVVLERPFQVAPHIQPICLPPPETPQMEAELR-SASCLATG 335
            .::..|     :||    :.:||||:.||.|.....:||||||     |:....|: ...|..||
  Rat   121 GDIIMHPKYWGQNF----IRSDIALLCLETPVTFNKYIQPICL-----PEHNFNLKVGMKCWVTG 176

  Fly   336 WG--LRYSTSRTMENL-LKRIELPAVDHESCQRLLRHTVLGRRYNLHP--------SFTCAGGVK 389
            ||  .::.:::...:| |...|:..||:::|.|:.      .:...:|        :..|....:
  Rat   177 WGQAKQHPSAKLTRSLELWEAEVSIVDNKNCDRVF------HKKTFYPQVIPLIRKNMICTTNHR 235

  Fly   390 GKDTCMGDGGSPLFCTLPGQKDRYQLVGLVSWGIECAEKDVPAAYTNVAYLRNWIDEQVTK 450
             ::.|.||.|.||.|.:.|   |:.|.|:.||...|.:....:.||.:.....||.|||::
  Rat   236 -ENPCYGDPGGPLACEVHG---RWILAGIFSWEKACTKAPNLSVYTRIDKYTGWIKEQVSR 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 71/251 (28%)
Tryp_SPc 207..444 CDD:214473 69/248 (28%)
Prss45NP_001008864.1 Tryp_SPc 57..289 CDD:238113 71/251 (28%)
Tryp_SPc 57..286 CDD:214473 69/248 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 162 1.000 Domainoid score I3893
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.