DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and CG6865

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster


Alignment Length:291 Identity:79/291 - (27%)
Similarity:128/291 - (43%) Gaps:67/291 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 CGYSNPKGLYYQLDGYNNGESVFAEFPWMVALMDMEGNFVCGGTLIHPQLVLTSAHNVFNRSEDS 252
            |...|||.:       ...|:...|.|:||:||...|:| ||||:|..:.:||:.|.:.|     
  Fly    28 CSVRNPKIV-------GGSEAERNEMPYMVSLMRRGGHF-CGGTIISERWILTAGHCICN----- 79

  Fly   253 LLVRAGDWDLNSQTELHPYQMRAISELHR------------------------HENFNNLTLYND 293
                      ..|..:.|.|::.:..||.                        |..::...:.:|
  Fly    80 ----------GLQQFMKPAQIQGVVGLHSIREYLNGIGNGPDALRVDFKNIVPHPQYDCNDVKHD 134

  Fly   294 IALVVLERPFQVAPHIQPICLPPPETPQ-MEAELRSASCLATGWGLRYSTSRTMEN----LLKRI 353
            |||:.|.:|.:.:.||||.|:...|..: :|.|..:.|    |||  ::.....||    :|::.
  Fly   135 IALLELVQPIRFSSHIQPSCVGSEEGHRSLEQEYGTVS----GWG--WTHENQAENDRSDVLRKA 193

  Fly   354 ELPAVDHESCQRLLRHTVLGRRYNLHPSFTCAGGVKGK-DTCMGDGGSPLFCTLPGQKDRYQLVG 417
            .:...::|:|:|..|.  ||:...:..:..|||...|: |:|..|.|.||      ....:.|||
  Fly   194 TVKIWNNEACERSYRS--LGKSNTIGETQLCAGYENGQIDSCWADSGGPL------MSKEHHLVG 250

  Fly   418 LVSWGIECAEKDVPAAYTNVAYLRNWIDEQV 448
            :||.||.||...:|..||.|:...:|:.:.:
  Fly   251 VVSTGIGCARPGLPGIYTRVSKYVSWMQKVI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 75/269 (28%)
Tryp_SPc 207..444 CDD:214473 74/266 (28%)
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 75/278 (27%)
Tryp_SPc 35..280 CDD:238113 75/281 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.