DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and CG4477

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_648295.1 Gene:CG4477 / 39058 FlyBaseID:FBgn0035971 Length:315 Species:Drosophila melanogaster


Alignment Length:301 Identity:75/301 - (24%)
Similarity:123/301 - (40%) Gaps:67/301 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 FLLKGCGYSNPKGLYYQL-------DGYNNGESVFAEFPWMVALMDMEG------NFVCGGTLIH 234
            |.|..|...:|:..:..|       ||..:.:|: |...:.|:|.....      |..|.|.::.
  Fly    15 FPLYNCLGDSPRNAFSSLNRVKRLSDGDFDEDSI-ALSNYCVSLRSRSAEKFFGDNHFCSGVILA 78

  Fly   235 PQLVLTSAHNVFNR-----SEDSLLVRAGDWD----LNSQTELHPYQMRAISELHRHENFNNLTL 290
            |..|:||||.:.|:     |...||:.||..:    :.::|.:.|     ::.:...::|   |:
  Fly    79 PMFVMTSAHCLINKRRVLISSRVLLIVAGTLNRLKYIPNRTFVTP-----VTHIWLPDSF---TM 135

  Fly   291 YN--DIALVVLERPF-QVAPHIQPICLP--PPETPQMEAELRSASCLATGWGLRYSTSRTMENLL 350
            .|  |..|:.::.|| :...||....||  ||        |....|...|||..|. ...:.:.:
  Fly   136 RNKQDFGLLKVKNPFPRNNEHISIARLPVHPP--------LPGLKCKVMGWGRMYK-GGPLASYM 191

  Fly   351 KRIELPAVDHESCQRLLRHTVLGRRYNLHPS--FTCA---GGVKGKDTCMGDGGSPLFCTLPGQK 410
            ..|::..:|.|:|.:.||          .||  ..||   ..:..:..|.||.|:|:.       
  Fly   192 LYIDVQVIDSEACAKWLR----------VPSVEHVCAVDSDDLTAQQPCGGDWGAPML------- 239

  Fly   411 DRYQLVGLVSWGIECAEKDVPAAYTNVAYLRNWIDEQVTKS 451
            ....:.|:|:....|....:|:.||||....|||.|::..|
  Fly   240 HNGTVYGIVTILAGCGVSHLPSLYTNVHSNANWIHEKIISS 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 66/264 (25%)
Tryp_SPc 207..444 CDD:214473 64/261 (25%)
CG4477NP_648295.1 Tryp_SPc 55..276 CDD:238113 64/254 (25%)
Tryp_SPc 55..273 CDD:214473 62/251 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.