DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and CG6462

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster


Alignment Length:266 Identity:66/266 - (24%)
Similarity:106/266 - (39%) Gaps:70/266 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 FPWMVAL-MDMEGNFV--CGGTLIHPQLVLTSAH--------------NVFNRSEDSLLVRAGDW 260
            ||:.|.| :.:.|..:  |||:||..|.|||:||              .||...|||        
  Fly    88 FPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATVFADVEDS-------- 144

  Fly   261 DLNSQTELHPYQMRAISEL---HR----HENFNNLTLYNDIALVVLERPFQVAPHIQPICLPPPE 318
                           :.||   ||    :.::.....|:|:||:.|.|..:.:..:|||      
  Fly   145 ---------------VEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPI------ 188

  Fly   319 TPQMEAELRSASCLA------TGWGLRYSTSRTMENLLKRIELPAVDHESCQRLLRHTVLGRRYN 377
              ::..|....:.|.      :|||....::.....||:.::...:|.|.|.......::.:|.:
  Fly   189 --ELAGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRH 251

  Fly   378 LHPSFTCAGGVKGKDTCMGDGGSPLFCTLPGQKDRYQLVGLVSWG-IECAEKDVPAAYTNVAYLR 441
            |     |..|..|:..|.||.|.|:   :...::...|:|:.|:| .|..|...|..||.:....
  Fly   252 L-----CTDGSNGRGACNGDSGGPV---VYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYL 308

  Fly   442 NWIDEQ 447
            .||.:|
  Fly   309 PWIRQQ 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 65/264 (25%)
Tryp_SPc 207..444 CDD:214473 63/261 (24%)
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 63/261 (24%)
Tryp_SPc 77..314 CDD:238113 65/264 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457456
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.