DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and CG30414

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:304 Identity:85/304 - (27%)
Similarity:125/304 - (41%) Gaps:90/304 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 CGYSNPKGLYYQLDGYNNGESVFAEFPWMVALMDMEGNFVCGGTLIHPQLVLTSAHNVFNRSEDS 252
            ||.:.|:.:.....|.:.|  :|:. ||||.::   |..:|||:||..:.|||:||.:.:   ..
  Fly    30 CGTTKPEFIPMITGGADAG--LFSN-PWMVKVL---GEKLCGGSLITSRFVLTAAHCIVS---TH 85

  Fly   253 LLVRAGDWDLN------SQTELHPYQMR------------------------AISELHRHENFNN 287
            :.||.|::...      |:.....|::|                        |:.....|.:: |
  Fly    86 MRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDCCVPKSYELAVDRKILHADY-N 149

  Fly   288 LTLYNDIALVVLERPFQVAPHIQPICLPPPETPQMEAELRSASCL-ATGWGLRYSTSRTMENLLK 351
            |.|.|||.|:.::...|.:.:::||||      .:|..:..:... .||||:             
  Fly   150 LNLDNDIGLLRMKSFVQYSDYVRPICL------LVEGHMAESPIFNITGWGV------------- 195

  Fly   352 RIELPAVDHESCQRLLRHTVLGRRYN--LH---PSFT--------CAGGVKGKDTCMGDGGSPLF 403
                 ..|....:||.|.||    ||  ||   ..||        ||.|. ..|.|.||.|.||.
  Fly   196 -----TNDGTPSRRLQRATV----YNTDLHFCRSKFTKQVDESQICAAGT-NSDACHGDSGGPLS 250

  Fly   404 CTLP--GQKDRYQLVGLVSWG-IECAEKDVPAAYTNVAYLRNWI 444
            ..:|  |....:| .||||:| ..|....|   ||||.:.|:||
  Fly   251 AQVPFAGSWLTFQ-YGLVSYGSAACHSFSV---YTNVTHHRDWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 80/285 (28%)
Tryp_SPc 207..444 CDD:214473 78/283 (28%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 80/291 (27%)
Tryp_SPc 41..290 CDD:238113 80/291 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.