DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and l(2)k05911

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster


Alignment Length:282 Identity:90/282 - (31%)
Similarity:133/282 - (47%) Gaps:21/282 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 RNPIQRNVKDFLLKGCGYSNPKGLYYQ--LDGYNNGESVFAEFPWMVALMDMEGNFVCGGTLIHP 235
            |.|:.....:.|...||..||.....:  :.|.|....   |||| :|::...|...|||:||..
  Fly   372 RRPVSGTSSEGLPLQCGNKNPVTPDQERIVGGINASPH---EFPW-IAVLFKSGKQFCGGSLITN 432

  Fly   236 QLVLTSAHNVFNRSE---DSLLVRAGDWDLNSQTELHPYQMRAISELHRHENFNNLTLYNDIALV 297
            ..:||:||.|...:.   .:|....||:::.:..|:. :..|.|..|.||:.|...||:||:|::
  Fly   433 SHILTAAHCVARMTSWDVAALTAHLGDYNIGTDFEVQ-HVSRRIKRLVRHKGFEFSTLHNDVAIL 496

  Fly   298 VLERPFQVAPHIQPICLPPPETPQMEAELRSASCLATGWG-LRYSTSRTMENLLKRIELPAVDHE 361
            .|..|......|||||||...:.|..:.....:.:| ||| ||  .:....::|:::::|...:.
  Fly   497 TLSEPVPFTREIQPICLPTSPSQQSRSYSGQVATVA-GWGSLR--ENGPQPSILQKVDIPIWTNA 558

  Fly   362 SCQRLLRHTVLGRRYNLHPSFTCAGGVKGKDTCMGDGGSPLFCTLPGQKDRYQLVGLVSWGIECA 426
            .|.|.......|   .:..|..|||.. .||:|.||.|.|:.....|   ||..||:|||||.|.
  Fly   559 ECARKYGRAAPG---GIIESMICAGQA-AKDSCSGDSGGPMVINDGG---RYTQVGIVSWGIGCG 616

  Fly   427 EKDVPAAYTNVAYLRNWIDEQV 448
            :...|..||.|..|..||.:.:
  Fly   617 KGQYPGVYTRVTSLLPWIYKNI 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 81/243 (33%)
Tryp_SPc 207..444 CDD:214473 79/240 (33%)
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
Tryp_SPc 399..634 CDD:214473 81/249 (33%)
Tryp_SPc 400..637 CDD:238113 83/251 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.