DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and prss60.3

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:253 Identity:80/253 - (31%)
Similarity:125/253 - (49%) Gaps:30/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 FPWMVALMDME-GNFVCGGTLIHPQLVLTSAHNVFNRSEDSLLVRAGDWDLNSQTELHPYQ-MRA 275
            :||.|:|...: |...|||:||..:.|||:||.:...||.:|:|..|   ..:|..::.|: .|.
Zfish    47 WPWQVSLHSPKYGGHFCGGSLISSEWVLTAAHCLSGVSETTLVVYLG---RRTQQGINIYETSRN 108

  Fly   276 ISELHRHENFNNLTLYNDIALVVLERPFQVAPHIQPICLPPPETPQMEAELRSASCLATGWG-LR 339
            :::...|.::|:.|..|||||:.|........:|:|:||    ..|........|...|||| ::
Zfish   109 VAKSFVHSSYNSNTNDNDIALLRLSSAVTFTNYIRPVCL----AAQNSVYSAGTSSWITGWGDIQ 169

  Fly   340 YSTSRTMENLLKRIELPAVDHESCQRLL-RHTVLGRRYNLHPSFTCAGGVK-GKDTCMGDGGSPL 402
            ...:.....:|:...:|.|.::.|..|| ..||..       :..|||..: |||||.||.|.|:
Zfish   170 AGVNLPAPGILQETMIPVVANDRCNALLGSGTVTN-------NMICAGLTQGGKDTCQGDSGGPM 227

  Fly   403 ---FCTLPGQKDRYQLVGLVSWGIECAEKDVPAAYTNVAYLRNWIDEQVT--KSGFPL 455
               .||:      :...|:.|||..||:.:.|..||.|:..::||..:::  |.||.|
Zfish   228 VTRLCTV------WVQAGITSWGYGCADPNSPGVYTRVSQYQSWISSKISLNKPGFIL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 76/241 (32%)
Tryp_SPc 207..444 CDD:214473 74/238 (31%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 76/241 (32%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587385
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.